LL-37 Peptide Vendor Checklist – What to Verify Before Purchasing

Choosing an LL-37 peptide vendor should involve more than finding a website with LL-37 listed for sale.

Researchers should evaluate whether the product information provides enough detail to make an informed procurement decision.

A useful vendor evaluation considers:

identity

quantity

purity

testing

COA

batch information

pricing

and

availability

Here are 10 areas researchers should verify before purchasing LL-37.

1. Verify the Compound Is LL-37

Start with molecular identity.

LL-37 is a 37-amino-acid peptide derived from the human cathelicidin precursor hCAP18.

Its sequence is:

[LL-37, 37 aa]

A supplier listing should clearly identify the intended research compound.

2. Verify the Listed Quantity

Determine exactly how much material the product contains.

Researchers specifically seeking 5mg can review:

https://peptideslabus.com/products/ll-37-5mg-research-peptide

Quantity should be selected according to the experimental protocol.

3. Review Purity Information

If a vendor reports a purity percentage, don’t stop at the number.

Ask:

• What analytical method generated the result?
• Which sample or batch was tested?
• Is supporting analytical information available?

The analytical context matters.

4. Review HPLC Information

HPLC is commonly used for chromatographic evaluation of peptides.

Researchers should determine whether HPLC information is available and what it actually reports.

A high chromatographic purity percentage doesn’t independently answer every question about molecular identity.

5. Look for Identity-Related Testing

A research product should be evaluated as a specific molecular material, not simply as a purity percentage.

Researchers should review available identity-related analytical information.

Where mass-spectrometric or other identity data are available, examine the actual reported result.

6. Review the Certificate of Analysis

A COA may provide important analytical information.

Look for:

• Compound name
• Batch/lot
• Purity
• Analytical method
• Identity-related results
• Other specifications

Don’t treat the phrase “COA available” as a substitute for reviewing the document.

7. Check Batch Traceability

Analytical information is more useful when researchers can determine which material was tested.

Look for a batch or lot identifier.

If the analytical report is historical, don’t automatically assume it represents current inventory.

8. Check Current Price

Current pricing should be reviewed through the live catalog:

https://peptideslabus.com/products?q=LL-37

Researchers should compare price relative to:

• Quantity
• Testing
• Documentation
• Product specifications

The lowest price isn’t automatically the strongest research procurement choice.

9. Verify Current Availability

A vendor may have an indexed product page even when current inventory has changed.

Researchers should verify availability through the live product listing.

Additional LL-37 listings can be reviewed here:

https://peptideslabus.com/products/crown-ll-37-research-peptide

https://peptideslabus.com/products/peptides-lab-ll37

10. Evaluate the Scientific Claims

A research supplier should distinguish experimental findings from established clinical evidence.

LL-37 has been investigated in laboratory and preclinical research involving innate immunity, host-defense mechanisms, microbial interactions, inflammatory signaling, cytokines, epithelial systems, and related areas.

Those findings shouldn’t be converted into claims that LL-37 is proven to treat infections, inflammatory diseases, wounds, or immune disorders.

Bonus: Distinguish LL-37 From hCAP18

Scientific literature frequently discusses both LL-37 and hCAP18.

The terms are related but aren’t identical.

hCAP18 is the precursor protein/peptide form from which LL-37 is generated.

Researchers purchasing LL-37 should verify that the intended product corresponds to LL-37.

Vendor Transparency Matters

Useful research-product listings should make it possible to determine what is actually being offered.

Researchers should be cautious when critical specifications are unclear.

Questions worth asking include:

What compound is supplied?

How much is supplied?

What testing supports the listing?

Which batch was tested?

What documentation is available?

LL-37 Vendor Checklist

Before purchasing:

1. Verify LL-37 identity.
2. Confirm the listed quantity.
3. Review purity information.
4. Examine HPLC data.
5. Review identity-related testing.
6. Examine the COA.
7. Check batch traceability.
8. Compare current price.
9. Confirm current availability.
10. Evaluate whether scientific claims reflect the actual evidence.

Browse LL-37 Research Products

https://peptideslabus.com/products?q=LL-37

A strong LL-37 vendor evaluation should focus on verifiable product information and analytical documentation rather than promotional language alone.

For laboratory research purposes only.